PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 167aa    MW: 18936.6 Da    PI: 10.1236
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30941.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.1e-53151421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeel+v+yLk+k+++++l++ ++i++vd+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l+  +++
  Dca30941.1  15 LPPGFRFHPTDEELIVHYLKRKASSSPLPV-SIIADVDLYKFDPWELPSKAIFGENEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILACnGNQ 112
                 79****************************.89***************7777799*************************************9875677 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vg+kk Lvfy g+ p+g+ktdW+mhe+rl
  Dca30941.1 113 RVGVKKALVFYGGKPPRGVKTDWIMHEFRL 142
                 7***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-619149IPR003441NAC domain
PROSITE profilePS5100557.78415167IPR003441NAC domain
PfamPF023655.4E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MESTDSSSTP SYPQLPPGFR FHPTDEELIV HYLKRKASSS PLPVSIIADV DLYKFDPWEL  60
PSKAIFGENE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILACNG NQRVGVKKAL  120
VFYGGKPPRG VKTDWIMHEF RLMDTHHASK RPLSFVAHPK KASLRVC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-661514417144NO APICAL MERISTEM PROTEIN
1ut4_B3e-661514417144NO APICAL MERISTEM PROTEIN
1ut7_A3e-661514417144NO APICAL MERISTEM PROTEIN
1ut7_B3e-661514417144NO APICAL MERISTEM PROTEIN
3swm_A3e-661514420147NAC domain-containing protein 19
3swm_B3e-661514420147NAC domain-containing protein 19
3swm_C3e-661514420147NAC domain-containing protein 19
3swm_D3e-661514420147NAC domain-containing protein 19
3swp_A3e-661514420147NAC domain-containing protein 19
3swp_B3e-661514420147NAC domain-containing protein 19
3swp_C3e-661514420147NAC domain-containing protein 19
3swp_D3e-661514420147NAC domain-containing protein 19
3ulx_A3e-661414214140Stress-induced transcription factor NAC1
4dul_A3e-661514417144NAC domain-containing protein 19
4dul_B3e-661514417144NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686575.11e-102PREDICTED: NAC transcription factor 25-like
SwissprotQ8GY428e-86NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0J8BT341e-102A0A0J8BT34_BETVU; Uncharacterized protein
STRINGVIT_00s0375g00040.t012e-94(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-87NAC domain containing protein 25